Chk2 Rabbit mAb, Clone: [ARC57076], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19543P
Artikelname: Chk2 Rabbit mAb, Clone: [ARC57076], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19543P
Hersteller Artikelnummer: CNA19543P
Alternativnummer: MBL-CNA19543P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Chk2 (O96017).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC57076]
Molekulargewicht: 15-38kDa/50-65kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQ
Target-Kategorie: CHEK2
Application Verdünnung: WB: WB,1:2000 - 1:8000|IHC-P,1:100 - 1:500