PKR/EIF2AK2 Rabbit mAb, Clone: [ARC0024], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19545S
Artikelname: PKR/EIF2AK2 Rabbit mAb, Clone: [ARC0024], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19545S
Hersteller Artikelnummer: CNA19545S
Alternativnummer: MBL-CNA19545S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-551 of human PKR/EIF2AK2 (P19525).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0024]
Molekulargewicht: 62kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC
Target-Kategorie: EIF2AK2
Application Verdünnung: WB: WB,1:500 - 1:1000