TBR1 Rabbit mAb, Clone: [ARC2198], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19550S
Artikelname: TBR1 Rabbit mAb, Clone: [ARC2198], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19550S
Hersteller Artikelnummer: CNA19550S
Alternativnummer: MBL-CNA19550S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBR1 (Q16650).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2198]
Molekulargewicht: 74kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGS
Target-Kategorie: TBR1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200