WNT2B Rabbit mAb, Clone: [ARC2172], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19554S
Artikelname: WNT2B Rabbit mAb, Clone: [ARC2172], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19554S
Hersteller Artikelnummer: CNA19554S
Alternativnummer: MBL-CNA19554S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human WNT2B (Q93097).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2172]
Molekulargewicht: 44kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
Target-Kategorie: WNT2B
Application Verdünnung: WB: WB,1:500 - 1:1000