Tau Rabbit mAb, Clone: [ARC0039], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19560S
Artikelname: Tau Rabbit mAb, Clone: [ARC0039], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19560S
Hersteller Artikelnummer: CNA19560S
Alternativnummer: MBL-CNA19560S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human Tau (NP_058519.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0039]
Molekulargewicht: 79kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPG
Target-Kategorie: MAPT
Application Verdünnung: WB: WB,1:500 - 1:2000