[KO Validated] STAT5B Rabbit mAb, Clone: [ARC0046], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19567S
Artikelname: [KO Validated] STAT5B Rabbit mAb, Clone: [ARC0046], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19567S
Hersteller Artikelnummer: CNA19567S
Alternativnummer: MBL-CNA19567S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-787 of human STAT5B (P51692).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0046]
Molekulargewicht: 90kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Target-Kategorie: STAT5B
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000