YY1 Rabbit mAb, Clone: [ARC0048], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19569S
Artikelname: YY1 Rabbit mAb, Clone: [ARC0048], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19569S
Hersteller Artikelnummer: CNA19569S
Alternativnummer: MBL-CNA19569S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY1 (P25490).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0048]
Molekulargewicht: 45kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
Target-Kategorie: YY1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:1000 - 1:5000|ChIP,1:1000 - 1:5000