SPOP Rabbit mAb, Clone: [ARC2181], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19578S
Artikelname: SPOP Rabbit mAb, Clone: [ARC2181], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19578S
Hersteller Artikelnummer: CNA19578S
Alternativnummer: MBL-CNA19578S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SPOP (O43791).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2181]
Molekulargewicht: 42kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA
Target-Kategorie: SPOP
Application Verdünnung: WB: WB,1:500 - 1:1000