Fas Rabbit mAb, Clone: [ARC0061], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19582P
Artikelname: Fas Rabbit mAb, Clone: [ARC0061], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19582P
Hersteller Artikelnummer: CNA19582P
Alternativnummer: MBL-CNA19582P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Fas (NP_000034.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0061]
Molekulargewicht: 38kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: EGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCE
Target-Kategorie: FAS
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200