[KO Validated] p53 Rabbit mAb, Clone: [ARC56085], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA19585P
| Artikelname: |
[KO Validated] p53 Rabbit mAb, Clone: [ARC56085], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA19585P |
| Hersteller Artikelnummer: |
CNA19585P |
| Alternativnummer: |
MBL-CNA19585P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IP, WB |
| Spezies Reaktivität: |
Human, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-393 of human p53 (NP_000537.3). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC56085] |
| Molekulargewicht: |
44kDa |
| Puffer: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,0.05% BSA,50% glycerol |
| Sequenz: |
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTI |
| Target-Kategorie: |
TP53 |
| Application Verdünnung: |
WB: WB,1:2000 - 1:20000|IP,1:500 - 1:1000 |
