[KD Validated] NQO1 Rabbit mAb, Clone: [ARC56753], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19586S
Artikelname: [KD Validated] NQO1 Rabbit mAb, Clone: [ARC56753], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19586S
Hersteller Artikelnummer: CNA19586S
Alternativnummer: MBL-CNA19586S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NQO1 (P15559).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC56753]
Molekulargewicht: 31kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIF
Target-Kategorie: NQO1
Application Verdünnung: WB: WB,1:5000 - 1:20000|IF/ICC,1:100 - 1:500