USP14 Rabbit mAb, Clone: [ARC2185], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA19589S
Artikelname: |
USP14 Rabbit mAb, Clone: [ARC2185], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA19589S |
Hersteller Artikelnummer: |
CNA19589S |
Alternativnummer: |
MBL-CNA19589S |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
IP, WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 371-473 of human USP14 (P54578). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC2185] |
Molekulargewicht: |
56kDa |
Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequenz: |
RSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWH |
Target-Kategorie: |
USP14 |
Application Verdünnung: |
WB: WB,1:500 - 1:1000|IP,1:1000 - 1:5000 |