SMC3 Rabbit mAb, Clone: [ARC2186], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19591S
Artikelname: SMC3 Rabbit mAb, Clone: [ARC2186], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19591S
Hersteller Artikelnummer: CNA19591S
Alternativnummer: MBL-CNA19591S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2186]
Molekulargewicht: 142kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG
Target-Kategorie: SMC3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000