PARP1 Rabbit mAb, Clone: [ARC0075], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19596P
Artikelname: PARP1 Rabbit mAb, Clone: [ARC0075], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19596P
Hersteller Artikelnummer: CNA19596P
Alternativnummer: MBL-CNA19596P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PARP1 (P09874).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0075]
Molekulargewicht: 113kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: KLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD
Target-Kategorie: PARP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200