NFAT2 Rabbit mAb, Clone: [ARC0076], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19597S
Artikelname: NFAT2 Rabbit mAb, Clone: [ARC0076], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19597S
Hersteller Artikelnummer: CNA19597S
Alternativnummer: MBL-CNA19597S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 844-943 of human NFAT2 (O95644).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0076]
Molekulargewicht: 101kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS
Target-Kategorie: NFATC1
Application Verdünnung: WB: WB,1:500 - 1:1000