NF-kappaB2 Rabbit mAb, Clone: [ARC0084], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19605S
Artikelname: NF-kappaB2 Rabbit mAb, Clone: [ARC0084], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19605S
Hersteller Artikelnummer: CNA19605S
Alternativnummer: MBL-CNA19605S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 745-877 of human NF-kappaB2 (Q00653).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0084]
Molekulargewicht: 97kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEA
Target-Kategorie: NFKB2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200