PPARgamma Rabbit mAb, Clone: [ARC0155], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19676S
Artikelname: PPARgamma Rabbit mAb, Clone: [ARC0155], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19676S
Hersteller Artikelnummer: CNA19676S
Alternativnummer: MBL-CNA19676S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARgamma (P37231).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0155]
Molekulargewicht: 58kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
Target-Kategorie: PPARG
Application Verdünnung: WB: WB,1:500 - 1:2000