[KD Validated] DNMT1 Rabbit mAb, Clone: [ARC51348], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19679P
Artikelname: [KD Validated] DNMT1 Rabbit mAb, Clone: [ARC51348], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19679P
Hersteller Artikelnummer: CNA19679P
Alternativnummer: MBL-CNA19679P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51348]
Molekulargewicht: 183kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN
Target-Kategorie: DNMT1
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000