GABA A Receptor beta 1 (GABRB1) Rabbit mAb, Clone: [ARC2229], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19681S
Artikelname: GABA A Receptor beta 1 (GABRB1) Rabbit mAb, Clone: [ARC2229], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19681S
Hersteller Artikelnummer: CNA19681S
Alternativnummer: MBL-CNA19681S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GABA A Receptor beta 1 (GABRB1) (NP_000803.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2229]
Molekulargewicht: 54kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTDVNSID
Target-Kategorie: GABRB1
Application Verdünnung: WB: WB,1:500 - 1:1000