[KD Validated] Casein Kinase 2 alpha (CSNK2A1) Rabbit mAb, Clone: [ARC0163], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19683S
Artikelname: [KD Validated] Casein Kinase 2 alpha (CSNK2A1) Rabbit mAb, Clone: [ARC0163], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19683S
Hersteller Artikelnummer: CNA19683S
Alternativnummer: MBL-CNA19683S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Casein Kinase 2 alpha (CSNK2A1) (P68400).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0163]
Molekulargewicht: 45kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
Target-Kategorie: CSNK2A1
Application Verdünnung: WB: WB,1:500 - 1:1000