MLKL Rabbit mAb, Clone: [ARC0165], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19685S
Artikelname: MLKL Rabbit mAb, Clone: [ARC0165], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19685S
Hersteller Artikelnummer: CNA19685S
Alternativnummer: MBL-CNA19685S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 373-471 of human MLKL (Q8NB16).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0165]
Molekulargewicht: 54kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: STAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK
Target-Kategorie: MLKL
Application Verdünnung: WB: WB,1:500 - 1:1000