FANCD2 Rabbit mAb, Clone: [ARC0172], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19692S
Artikelname: FANCD2 Rabbit mAb, Clone: [ARC0172], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19692S
Hersteller Artikelnummer: CNA19692S
Alternativnummer: MBL-CNA19692S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human FANCD2 (Q9BXW9).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0172]
Molekulargewicht: 164kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTSLTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISE
Target-Kategorie: FANCD2
Application Verdünnung: WB: WB,1:500 - 1:1000