Bcl-2 Rabbit mAb, Clone: [ARC0173], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19693S
Artikelname: Bcl-2 Rabbit mAb, Clone: [ARC0173], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19693S
Hersteller Artikelnummer: CNA19693S
Alternativnummer: MBL-CNA19693S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-211 of human Bcl-2 (P10415).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0173]
Molekulargewicht: 26kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Target-Kategorie: BCL2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:50 - 1:200