IKKalpha Rabbit mAb, Clone: [ARC0174], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19694S
Artikelname: IKKalpha Rabbit mAb, Clone: [ARC0174], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19694S
Hersteller Artikelnummer: CNA19694S
Alternativnummer: MBL-CNA19694S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IKKalpha (NP_001269.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0174]
Molekulargewicht: 85kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSG
Target-Kategorie: CHUK
Application Verdünnung: WB: WB,1:500 - 1:2000