Hippocalcin (HPCA) Rabbit mAb, Clone: [ARC2235], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19696S
Artikelname: Hippocalcin (HPCA) Rabbit mAb, Clone: [ARC2235], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19696S
Hersteller Artikelnummer: CNA19696S
Alternativnummer: MBL-CNA19696S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hippocalcin (HPCA) (P84074).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2235]
Molekulargewicht: 22kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQK
Target-Kategorie: HPCA
Application Verdünnung: WB: WB,1:500 - 1:2000