Progesterone Receptor Rabbit mAb, Clone: [ARC51400], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19697P
Artikelname: Progesterone Receptor Rabbit mAb, Clone: [ARC51400], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19697P
Hersteller Artikelnummer: CNA19697P
Alternativnummer: MBL-CNA19697P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51400]
Molekulargewicht: 99kd(CST:90,118KD)
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: AAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYD
Target-Kategorie: PGR
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200