SQSTM1/p62 Rabbit mAb, Clone: [ARC0180], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19700S
Artikelname: SQSTM1/p62 Rabbit mAb, Clone: [ARC0180], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19700S
Hersteller Artikelnummer: CNA19700S
Alternativnummer: MBL-CNA19700S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 341-440 of human SQSTM1/p62 (Q13501).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0180]
Molekulargewicht: 48kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Target-Kategorie: SQSTM1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000