NOX2/gp91phox Rabbit mAb, Clone: [ARC0181], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19701S
Artikelname: NOX2/gp91phox Rabbit mAb, Clone: [ARC0181], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19701S
Hersteller Artikelnummer: CNA19701S
Alternativnummer: MBL-CNA19701S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (P04839).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0181]
Molekulargewicht: 65kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: FHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS
Target-Kategorie: CYBB
Application Verdünnung: WB: WB,1:500 - 1:2000