Human IgA Rabbit mAb, Clone: [ARC2239], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19704S
Artikelname: Human IgA Rabbit mAb, Clone: [ARC2239], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19704S
Hersteller Artikelnummer: CNA19704S
Alternativnummer: MBL-CNA19704S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-353 of human IgA (P01876).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2239]
Molekulargewicht: 60kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARG
Target-Kategorie: IGHA1/IGHA2
Application Verdünnung: WB: WB,1:500 - 1:1000