Human IgG3 Rabbit mAb, Clone: [ARC2243], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19713S
Artikelname: Human IgG3 Rabbit mAb, Clone: [ARC2243], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19713S
Hersteller Artikelnummer: CNA19713S
Alternativnummer: MBL-CNA19713S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IgG3 (P01860).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2243]
Molekulargewicht: 41kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSC
Target-Kategorie: IGHG3
Application Verdünnung: WB: WB,1:1000 - 1:5000