IkappaBalpha Rabbit mAb, Clone: [ARC0194], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19714S
Artikelname: IkappaBalpha Rabbit mAb, Clone: [ARC0194], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19714S
Hersteller Artikelnummer: CNA19714S
Alternativnummer: MBL-CNA19714S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IkappaBalpha (P25963).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0194]
Molekulargewicht: 36kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGD
Target-Kategorie: NFKBIA
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000