Human IgM Rabbit mAb, Clone: [ARC2245], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19719S
Artikelname: Human IgM Rabbit mAb, Clone: [ARC2245], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19719S
Hersteller Artikelnummer: CNA19719S
Alternativnummer: MBL-CNA19719S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-453 of human IgM (P01871).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2245]
Molekulargewicht: 49kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDS
Target-Kategorie: IGHM
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200