CD239/BCAM Rabbit mAb, Clone: [ARC2252], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19724S
Artikelname: CD239/BCAM Rabbit mAb, Clone: [ARC2252], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19724S
Hersteller Artikelnummer: CNA19724S
Alternativnummer: MBL-CNA19724S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 529-628 of human CD239/BCAM (P50895).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2252]
Molekulargewicht: 67kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
Target-Kategorie: BCAM
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200