TPO-R/CD110/c-Mpl Rabbit mAb, Clone: [ARC2257], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19729S
Artikelname: TPO-R/CD110/c-Mpl Rabbit mAb, Clone: [ARC2257], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19729S
Hersteller Artikelnummer: CNA19729S
Alternativnummer: MBL-CNA19729S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 536-635 of human TPO-R/CD110/c-Mpl (P40238).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2257]
Molekulargewicht: 71kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: HRVLGQYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLGTMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Target-Kategorie: MPL
Application Verdünnung: WB: WB,1:500 - 1:2000