NDUFB8 Rabbit mAb, Clone: [ARC2259], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19732S
Artikelname: NDUFB8 Rabbit mAb, Clone: [ARC2259], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19732S
Hersteller Artikelnummer: CNA19732S
Alternativnummer: MBL-CNA19732S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFB8 (O95169).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2259]
Molekulargewicht: 22kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVY
Target-Kategorie: NDUFB8
Application Verdünnung: WB: WB,1:1000 - 1:3000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200