PLC beta 3 (PLCB3) Rabbit mAb, Clone: [ARC2269], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19738S
Artikelname: PLC beta 3 (PLCB3) Rabbit mAb, Clone: [ARC2269], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19738S
Hersteller Artikelnummer: CNA19738S
Alternativnummer: MBL-CNA19738S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human PLC beta 3 (PLC beta 3 (PLCB3)) (Q01970).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2269]
Molekulargewicht: 139kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
Target-Kategorie: PLCB3
Application Verdünnung: WB: WB,1:500 - 1:1000