PRKAR2B Rabbit mAb, Clone: [ARC2272], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19745S
Artikelname: PRKAR2B Rabbit mAb, Clone: [ARC2272], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19745S
Hersteller Artikelnummer: CNA19745S
Alternativnummer: MBL-CNA19745S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 319-418 of human PRKAR2B (P31323).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2272]
Molekulargewicht: 46kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Target-Kategorie: PRKAR2B
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200