Rad21 Rabbit mAb, Clone: [ARC2276], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA19749S
Artikelname: |
Rad21 Rabbit mAb, Clone: [ARC2276], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA19749S |
Hersteller Artikelnummer: |
CNA19749S |
Alternativnummer: |
MBL-CNA19749S |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ChIP, WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC2276] |
Molekulargewicht: |
72kDa |
Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequenz: |
EKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII |
Target-Kategorie: |
RAD21 |
Application Verdünnung: |
WB: WB,1:500 - 1:2000|ChIP,1:50 - 1:200 |