RING1A Rabbit mAb, Clone: [ARC2278], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19750S
Artikelname: RING1A Rabbit mAb, Clone: [ARC2278], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19750S
Hersteller Artikelnummer: CNA19750S
Alternativnummer: MBL-CNA19750S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RING1A A (Q06587).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2278]
Molekulargewicht: 42kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAP
Target-Kategorie: RING1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000