SLC22A3/OCT3 Rabbit mAb, Clone: [ARC2285], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19758S
Artikelname: SLC22A3/OCT3 Rabbit mAb, Clone: [ARC2285], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19758S
Hersteller Artikelnummer: CNA19758S
Alternativnummer: MBL-CNA19758S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 301-450 of human SLC22A3/OCT3 (O75751).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2285]
Molekulargewicht: 61kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVACLVTAFLPEGIAWLRTTVATLGRLGITMAF
Target-Kategorie: SLC22A3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200