WDR4 Rabbit mAb, Clone: [ARC2292], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19765S
Artikelname: WDR4 Rabbit mAb, Clone: [ARC2292], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19765S
Hersteller Artikelnummer: CNA19765S
Alternativnummer: MBL-CNA19765S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human WDR4 (P57081).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2292]
Molekulargewicht: 45kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: AFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS
Target-Kategorie: WDR4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200