ERp29 Rabbit mAb, Clone: [ARC2295], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19771S
Artikelname: ERp29 Rabbit mAb, Clone: [ARC2295], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19771S
Hersteller Artikelnummer: CNA19771S
Alternativnummer: MBL-CNA19771S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2295]
Molekulargewicht: 29kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM
Target-Kategorie: ERP29
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200