Transportin 3 (TNPO3) Rabbit mAb, Clone: [ARC2310], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19774S
Artikelname: Transportin 3 (TNPO3) Rabbit mAb, Clone: [ARC2310], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19774S
Hersteller Artikelnummer: CNA19774S
Alternativnummer: MBL-CNA19774S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Transportin 3 (Transportin 3 (TNPO3)) (Q9Y5L0).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2310]
Molekulargewicht: 104kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: QVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRPTFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLFR
Target-Kategorie: TNPO3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200