AIF1/IBA1 Rabbit mAb, Clone: [ARC2301], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19776S
Artikelname: AIF1/IBA1 Rabbit mAb, Clone: [ARC2301], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19776S
Hersteller Artikelnummer: CNA19776S
Alternativnummer: MBL-CNA19776S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse AIF1/IBA1 (O70200).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2301]
Molekulargewicht: 17kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEET
Target-Kategorie: Aif1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200