GOLPH4 Rabbit mAb, Clone: [ARC2315], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19790S
Artikelname: GOLPH4 Rabbit mAb, Clone: [ARC2315], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19790S
Hersteller Artikelnummer: CNA19790S
Alternativnummer: MBL-CNA19790S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GOLPH4 (O00461).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2315]
Molekulargewicht: 82kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETL
Target-Kategorie: GOLIM4
Application Verdünnung: WB: WB,1:500 - 1:1000