TMPRSS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1979P
Artikelname: TMPRSS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1979P
Hersteller Artikelnummer: CNA1979P
Alternativnummer: MBL-CNA1979P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TMPRSS2 (NP_005647.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 54kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAAL
Target-Kategorie: TMPRSS2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200