STK33 Rabbit mAb, Clone: [ARC2330], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19803S
Artikelname: STK33 Rabbit mAb, Clone: [ARC2330], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19803S
Hersteller Artikelnummer: CNA19803S
Alternativnummer: MBL-CNA19803S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 399-514 of human STK33 (Q9BYT3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2330]
Molekulargewicht: 58kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL
Target-Kategorie: STK33
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200