CTIP2/BCL11B Rabbit mAb, Clone: [ARC2329], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19804S
Artikelname: CTIP2/BCL11B Rabbit mAb, Clone: [ARC2329], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19804S
Hersteller Artikelnummer: CNA19804S
Alternativnummer: MBL-CNA19804S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human CTIP2/BCL11B (Q9C0K0).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2329]
Molekulargewicht: 96kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEEEEELLLENES
Target-Kategorie: BCL11B
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200