BCL2L12 Rabbit mAb, Clone: [ARC2334], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19808S
Artikelname: BCL2L12 Rabbit mAb, Clone: [ARC2334], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19808S
Hersteller Artikelnummer: CNA19808S
Alternativnummer: MBL-CNA19808S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2334]
Molekulargewicht: 37kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL
Target-Kategorie: BCL2L12
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:100 - 1:500|IHC-P,1:50 - 1:200