Histone H2B Rabbit mAb, Clone: [ARC2337], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19812S
Artikelname: Histone H2B Rabbit mAb, Clone: [ARC2337], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19812S
Hersteller Artikelnummer: CNA19812S
Alternativnummer: MBL-CNA19812S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 47-126 of human Histone H2B (O60814).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2337]
Molekulargewicht: 14kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Target-Kategorie: H2BC12
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200